Thhalv10001160m (PRGDB233145)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB233145	Thhalv10001160m	T	putative	TIR	Eutrema salsugineum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thhalv10001159m	Eutrema salsugineum	78.8	160	5e-84
Cagra.1410s0001.1.p	Conradina grandiflora	76.1	138	3e-67
338955	Arabidopsis lyrata	63.3	158	2e-65
Cagra.0629s0015.1.p	Conradina grandiflora	65.1	152	9e-63
Bostr.8819s0041.1.p	Babiana stricta	63.3	147	1e-61
Bostr.5342s0012.1.p	Babiana stricta	64.6	147	2e-60
Bostr.8819s0034.1.p	Babiana stricta	63.3	158	7e-59
Bostr.8819s0022.1.p	Babiana stricta	63.3	147	2e-58
AT5G45220.1	Arabidopsis thaliana	61.2	147	1e-57
Araha.5635s0001.1.p	Arabidopsis halleri	62.8	145	2e-57

Showing 1 to 10 of 499 entries

Protein sequence

MDVTSRHSPQAKHQVFVNFRGDELRCGFVSHLVEALQRQRINVFIDKLERIGEDLSNLFVRIEESTIALV
IFSRRYMESKWCLDELVKIKQRADQGLLRVIPIFFKVDPVTVKQLRGAFGDQFRDREWEYRFDKPIIERW
KEALASVSCKIGLTFDKK