mrna08356.1-v1.0-hybrid (PRGDB234611)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB234611	mrna08356.1-v1.0-hybrid	T	putative	TIR	Fragaria vesca

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000122961	Malus domestica	43.6	140	1e-26
Prupe.2G101900.5.p	Prunus persica	43.9	139	4e-24
Prupe.2G101900.3.p	Prunus persica	43.9	139	4e-24
Prupe.2G101900.2.p	Prunus persica	43.9	139	4e-24
Prupe.2G101900.1.p	Prunus persica	43.9	139	5e-24
Prupe.3G010300.1.p	Prunus persica	40.7	118	4e-21
MDP0000559205	Malus domestica	39.8	118	2e-17
Prupe.3G130900.1.p	Prunus persica	39.1	115	5e-17
mrna08320.1-v1.0-hybrid	Fragaria vesca	47.5	101	3e-16
MDP0000268226	Malus domestica	38.7	124	5e-15

Showing 1 to 10 of 13 entries

Protein sequence

MVSKWRRALKDVADLGGMVLGDHHWPFGTDDQQGGEELCVSVDQGYENLIKDFGVQLVYEQENRGNTCEG
VQSNGEDVTVHQQVSYWSQDHVVGDVSVSASMYQMWRGKYFLCNLRFDAYQNQFKWSLRNPALLDFSYEP
DGPYNFLCKHQAAEDCEEN