mrna23387.1-v1.0-hybrid (PRGDB234708)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB234708	mrna23387.1-v1.0-hybrid	N	putative	NBS	Fragaria vesca

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
29939.m000530	Ricinus communis	87.2	94	4e-55
Thecc1EG042970t1	Theobroma cacao	84	94	1e-52
Thecc1EG042967t1	Theobroma cacao	83	94	2e-51
VIT_00s0317g00020.t01	Vitis vinifera	78.7	94	3e-46
VIT_14s0036g00440.t01	Vitis vinifera	72.5	98	8e-44
Kalax.0170s0067.1.p	Kalanchoe marnieriana	71.1	97	4e-42
Manes.10G037300.2.p	Manihot esculenta	77.4	84	1e-41
Cucsa.165620.1	Cucumis sativus	67.4	92	5e-41
evm.model.supercontig_1.330	Carica papaya	69.1	97	9e-39
Aqcoe1G475900.1.p	Aquilegia caerulea	72.4	87	7e-38

Showing 1 to 10 of 20 entries

Protein sequence

MGDSSASYIHLVQHLIEKCLIFHMSKEECMEALSKHANITPVITSTVWNELEKENKEFFEAYAVSQNKKN
QMSEEETSQLIQKIISDSSKDSDD