Glyma.01G119800.1.p (PRGDB236318)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB236318	Glyma.01G119800.1.p	T	putative	TIR	Glycine max

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.01G032900.1.p	Glycine max	85	140	2e-78
Glyma.01G033200.1.p	Glycine max	84.5	142	3e-77
Glyma.01G033300.1.p	Glycine max	83.5	139	1e-75
Medtr8g090280.1	Medicago truncatula	69.3	150	3e-64
Phvul.002G323000.1	Phaseolus vulgaris	69.7	142	1e-63
Phvul.002G323800.2	Phaseolus vulgaris	70.4	142	3e-62
Phvul.002G323800.3	Phaseolus vulgaris	70.4	142	3e-62
Phvul.002G323800.1	Phaseolus vulgaris	70.4	142	3e-62
Phvul.002G323300.1	Phaseolus vulgaris	70.7	140	6e-62
Phvul.007G160900.1	Phaseolus vulgaris	64	164	1e-61

Showing 1 to 10 of 499 entries

Protein sequence

MAGSSSSAAVGEDTRDNFISHIYEELQRKKIETYIDYRLARGEEISPALHRAIEKSTIYVVIFSQNYASS
TWCLEELTKILDCKNRYGRDVIPVFYKVDPSIVRHQRETYAEALVKHEHRFKDNLGKVHAWKAALKEAAG
LVGWHSQVTRQKLLRFVLAGCRTLDSENTKVCADH