evm_27.model.AmTr_v1.0_scaffold00078.107 (PRGDB23938)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB23938	evm_27.model.AmTr_v1.0_scaffold00078.107	T	putative	TM, TIR	Amborella trichopoda

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
evm_27.model.AmTr_v1.0_scaffold00056.119	Amborella trichopoda	37	119	7e-14
evm_27.model.AmTr_v1.0_scaffold00024.254	Amborella trichopoda	32.8	116	2e-11
Prupe.8G023500.1.p	Prunus persica	30.5	131	1e-10
Medtr2g037690.1	Medicago truncatula	31.5	111	5e-10
Prupe.8G023200.2.p	Prunus persica	29.8	131	9e-10
Prupe.8G023200.1.p	Prunus persica	29.8	131	9e-10
evm_27.model.AmTr_v1.0_scaffold00001.586	Amborella trichopoda	49.1	59	1e-9
Potri.019G069500.2	Populus trichocarpa	39.7	78	3e-9
Potri.019G069500.1	Populus trichocarpa	39.7	78	3e-9
Potri.019G070700.1	Populus trichocarpa	34.3	108	1e-8

Showing 1 to 10 of 44 entries

Protein sequence

MRTRFGTPAFRFDNEVSRAIALRQWRIALRQYKQALRPSEYHLRQYRNDAFDEDMMQRWRDDLKQFADLS
GWDMKNRKNEANLVQELVRHVLNKLTYTKPSNLNSSTPQLVGMNSSTSTITLHLMAMNSSISTLQLVLLN
RRAFGRDRPNLLNSLTPQLVGINSSTSTLQLVVFFNFNSSVGGVQSVCI