evm_27.model.AmTr_v1.0_scaffold00060.164 (PRGDB23940)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB23940	evm_27.model.AmTr_v1.0_scaffold00060.164	T	putative	TM, TIR	Amborella trichopoda

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
evm_27.model.AmTr_v1.0_scaffold00060.163	Amborella trichopoda	75.6	209	4e-95
evm_27.model.AmTr_v1.0_scaffold00010.356	Amborella trichopoda	72.7	209	2e-89
Potri.007G143100.3	Populus trichocarpa	35.6	90	2e-11
SapurV1A.0340s0140.1.p	Salix purpurea	38.5	91	3e-11
Potri.007G143100.1	Populus trichocarpa	35.6	90	6e-11
Potri.007G142500.1	Populus trichocarpa	35.6	90	6e-11
Medtr5g047530.1	Medicago truncatula	33	100	7e-11
Potri.007G143100.2	Populus trichocarpa	35.6	90	7e-11
29747.m001050	Ricinus communis	34.7	95	9e-11
Kalax.0089s0033.1.p	Kalanchoe marnieriana	33.7	101	2e-10

Showing 1 to 10 of 370 entries

Protein sequence

MPRSSSSRAQKLFSGCFGPDTSTMEVNKCNMDSRKCEIFICHSPSLEVQNGIAKDLLLLLQKLNISTLCS
RDCSIPIEEVHMIPIFYDVRPSEVRRTEKGIFRPAFVGAAKYTQKEEWKFFLQKTGYLSGWKFSDFRWNS
CKLLKAVVQDVIKMVNANVLEVVKHPVGLAEKTEKL