evm_27.model.AmTr_v1.0_scaffold00025.338 (PRGDB24001)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB24001	evm_27.model.AmTr_v1.0_scaffold00025.338	RLP	putative	TM, LRR	Amborella trichopoda

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Lus10028097	Linum usitatissimum	74.7	142	5e-68
Thecc1EG039836t1	Theobroma cacao	59.6	203	8e-67
Cagra.0077s0004.1.p	Conradina grandiflora	74.1	139	9e-67
Lus10040566	Linum usitatissimum	73.2	142	4e-66
Bo9g037330.1	Brassica oleracea	68.4	155	7e-66
Araha.11097s0008.1.p	Arabidopsis halleri	75.2	133	4e-65
Potri.006G081200.1	Populus trichocarpa	63.9	169	8e-65
Potri.018G151000.1	Populus trichocarpa	62	171	4e-64
Gorai.012G009700.2	Gossypium raimondii	58.2	196	5e-64
Gorai.012G009700.1	Gossypium raimondii	58.3	199	5e-64

Showing 1 to 10 of 499 entries

Protein sequence

MPTMPPPLSLLLFSLSLLLLSLSSQAQTPASSGQTVTINPTFRFQNPSLRRAYYALQTWKKFAIFSDPFN
QTGNWIGPDVCHYNGVFCAPSPSDSSLNVVAGIDLNHADIAGYLPPELGLLSDLALFHINSNRFCGVVPP
TFKRMKLLFELDLSNNRFVGHFPAVVLKLPLSSTWISGSMTSKAPFLQRYLTSLWMPYFLTITV