Gorai.002G073500.1 (PRGDB241861)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB241861	Gorai.002G073500.1	T	putative	TIR	Gossypium raimondii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thecc1EG031369t1	Theobroma cacao	82.2	197	2e-115
Gorai.009G433600.1	Gossypium raimondii	81.5	200	9e-114
Gorai.004G029200.1	Gossypium raimondii	76.4	199	1e-102
Potri.001G403800.1	Populus trichocarpa	73.9	184	1e-97
Potri.011G123100.1	Populus trichocarpa	82.5	160	3e-96
Manes.03G113800.1.p	Manihot esculenta	69.6	184	2e-91
Manes.15G084900.1.p	Manihot esculenta	69.4	183	1e-90
Ciclev10010354m	Citrus clementina	70	180	5e-90
orange1.1g044205m	Citrus sinensis	70	180	5e-90
Prupe.4G186200.1.p	Prunus persica	68.8	189	2e-89

Showing 1 to 10 of 499 entries

Protein sequence

MHMQRYSSAAMKMMNFHRNFLALQTPTNPLVTNKACDVFINHRGIDTKRTIATLLYDHLSRLNLQPFLDN
KNMKPGDKLFDNIDNAIKNCKVGITVFSPNYCKSYFCLHELALIMESKKKVIPIFCDIKPSQLALVNNGT
VPDKDLERFKLAIEEAKNTVGLTFDSLKGNWSDVVTSASEIVIESLIEMKSEEI