Gorai.007G343200.3 (PRGDB241875)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB241875	Gorai.007G343200.3	N	putative	NBS, TM	Gossypium raimondii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Gorai.007G343200.2	Gossypium raimondii	99.9	159	4e-114
Gorai.007G343200.4	Gossypium raimondii	99.9	159	4e-114
Gorai.007G343200.1	Gossypium raimondii	99.9	159	4e-114
Thecc1EG026470t1	Theobroma cacao	92.5	160	7e-103
Gorai.013G203300.1	Gossypium raimondii	90.6	160	6e-102
Prupe.7G004400.2.p	Prunus persica	90	160	7e-101
Prupe.7G004400.1.p	Prunus persica	90	160	7e-101
Glyma.16G040900.2.p	Glycine max	86.5	163	9e-101
orange1.1g029623m	Citrus sinensis	87.7	162	1e-100
orange1.1g029613m	Citrus sinensis	87.7	162	1e-100

Showing 1 to 10 of 365 entries

Protein sequence

MSTMGNSTNIFWQESPVGKLERRKLLNQKGCVVWITGLSGSGKSTLACSLSWELHTRGKLSYILDGDNVR
HGLNKDLGFKAEDRTENIRRVGEVAKLFADAGLICIASLISPYGKDRDACRAMLPDAFIEVFMNMPLALC
EERDPKGLYKLARAGKIKGVLLA