Gorai.009G433700.1 (PRGDB241901)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB241901	Gorai.009G433700.1	L	putative	LRR	Gossypium raimondii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000667502	Malus domestica	53.2	79	6e-19
MDP0000830476	Malus domestica	51.9	79	1e-18
Thecc1EG025545t6	Theobroma cacao	54.4	79	1e-18
Thecc1EG025545t5	Theobroma cacao	54.4	79	1e-18
Thecc1EG025545t4	Theobroma cacao	54.4	79	1e-18
Thecc1EG025545t3	Theobroma cacao	54.4	79	1e-18
Thecc1EG025545t2	Theobroma cacao	54.4	79	1e-18
Thecc1EG025545t1	Theobroma cacao	54.4	79	1e-18
Manes.09G023800.1.p	Manihot esculenta	52.6	76	2e-18
MDP0000182716	Malus domestica	51.9	79	2e-18

Showing 1 to 10 of 380 entries

Protein sequence

MKRVKEIPNFICLLQNLQTLILDGCTTVEELPKDVQNLSGLTMQSITTKQRFLPENGVGRLICLRFLAIT
GCQNLKYLPQVEFDNAMMGACLRGYHRMGKQFGSYSKHKLMYFLECFFIT