Gorai.006G267600.3 (PRGDB242100)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB242100	Gorai.006G267600.3	L	putative	LRR	Gossypium raimondii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Gorai.006G267600.1	Gossypium raimondii	99.9	193	4e-134
Gorai.006G267600.2	Gossypium raimondii	99.9	193	4e-134
Thecc1EG014164t1	Theobroma cacao	92.2	193	1e-124
Thecc1EG014164t2	Theobroma cacao	92.6	189	2e-122
Manes.06G087000.1.p	Manihot esculenta	88.6	193	1e-117
Potri.015G048800.4	Populus trichocarpa	86.5	193	1e-116
Potri.015G048800.3	Populus trichocarpa	86.5	193	1e-116
Potri.015G048800.2	Populus trichocarpa	86.5	193	3e-116
SapurV1A.0178s0080.3.p	Salix purpurea	86	193	1e-115
SapurV1A.0582s0100.3.p	Salix purpurea	86	193	2e-115

Showing 1 to 10 of 499 entries

Protein sequence

MQRLILATNLIERLPINIGKLQSLKVMILDGNQITSLPDELGQLVRLEKLSISGNMLMSLPETIGSLRNL
SLLNVSNNKLKYLPESVGSCFSLEELQANDNLIEELPASVCNLVHLKSLCLNNNKVSQIPPNLLKDCKAL
QNISLHGNPISMDQFQQMEGFQEFEARRKKKFDKQIDSNVMIGSNGLDEGVDL