MLOC_28382.1 (PRGDB245953)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB245953	MLOC_28382.1	T	putative	TM, TIR	Hordeum vulgare

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MLOC_21207.1	Hordeum vulgare	76	96	3e-43
Bradi4g15017.6.p	Brachypodium distachyon	46.5	71	9e-14
Bradi4g15017.3.p	Brachypodium distachyon	46.5	71	1e-13
Bradi4g15017.4.p	Brachypodium distachyon	46.5	71	1e-13
Bradi4g15017.7.p	Brachypodium distachyon	46.5	71	1e-13
Bradi4g15017.2.p	Brachypodium distachyon	46.5	71	1e-13
Bradi4g15017.5.p	Brachypodium distachyon	46.5	71	2e-13
EMT12554	Aegilops tauschii	46	63	3e-12
EMT32588	Aegilops tauschii	40.3	67	3e-8
LOC_Os01g02760.1	Oryza sativa	39	77	3e-7

Showing 1 to 10 of 11 entries

Protein sequence

MSWLRLPTPVPDQDATLQDWWLRACDATPPPLHKALASVALLVPWVIWKHRNACVFYHVPPSLVELADAI
KDESRSWAKAGAKGLRVTLPSSWDVH