MLOC_12790.1 (PRGDB245972)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB245972	MLOC_12790.1	N	putative	NBS, TM	Hordeum vulgare

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MLOC_12790.2	Hordeum vulgare	98.7	155	5e-110
MLOC_12790.3	Hordeum vulgare	86	178	3e-104
Bradi1g71030.3.p	Brachypodium distachyon	94.2	155	1e-100
Brast02G083200.1.p	Brachypodium stacei	92.8	153	2e-99
Traes_4AS_A795672BE.8	Triticum aestivum	97.2	141	2e-97
Sobic.001G465900.1.p	Sorghum bicolor	87.7	155	6e-95
Pavir.J07626.2.p	Panicum virgatum	88.2	153	1e-94
Pavir.J07626.1.p	Panicum virgatum	88.2	153	2e-94
MLOC_12790.4	Hordeum vulgare	98.5	134	2e-93
Sevir.9G505300.1.p	Setaria viridis	87.1	155	2e-93

Showing 1 to 10 of 365 entries

Protein sequence

MEQQHLQAGSASGSPVREKPVMSNIGKSTNILWHDCPIGQSERQKLLGQKGCVIWITGLSGSGKSTVACA
LSRELHYRGHHTYVLDGDNLRHGLNRDLSFKAEDRTENIRRVGEVAKLFADAGTICIASLISPYRRDRDA
CRALLPDSRFIEVCLLYDSLKPC