Aco021404.1 (PRGDB24973)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB24973	Aco021404.1	RLP	putative	TM, LRR	Ananas comosus

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Aco011617.1	Ananas comosus	92.4	79	1e-39
Sobic.004G035800.1.p	Sorghum bicolor	82.3	79	5e-36
Aco028552.1	Ananas comosus	87.2	78	6e-36
Traes_6AS_A883BC2B1.2	Triticum aestivum	81	79	1e-35
MLOC_3226.1	Hordeum vulgare	78.5	79	1e-35
Traes_6AS_A883BC2B1.1	Triticum aestivum	81	79	2e-35
OPUNC02G02460.1	Oryza punctata	81	79	2e-35
OPUNC06G24390.1	Oryza punctata	81	79	9e-35
Pavir.Aa03325.1.p	Panicum virgatum	78.5	79	3e-34
ONIVA02G02950.1	Oryza nivara	79.8	79	6e-34

Showing 1 to 10 of 499 entries

Protein sequence

MSSGTVPSPASPSLLHKLNLLFDRPLDTIFLNSNRLRRCRPIPANLGDSPASIVVLAHNKLGGCIPPSIG
RMADTLNEIVLLDDGLAACVPLEVGLLRRG