Kalax.0447s0011.1.p (PRGDB250143)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB250143	Kalax.0447s0011.1.p	N	putative	NBS	Kalanchoe marnieriana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Kalax.0357s0019.1.p	Kalanchoe marnieriana	99.5	208	3e-152
VIT_08s0007g07370.t01	Vitis vinifera	88.3	206	2e-137
Prupe.7G004400.2.p	Prunus persica	88.9	208	5e-137
Prupe.7G004400.1.p	Prunus persica	88.9	208	5e-137
29950.m001128	Ricinus communis	88.8	205	2e-136
Manes.09G141100.1.p	Manihot esculenta	88.8	205	9e-136
Thecc1EG026470t1	Theobroma cacao	87.9	206	1e-135
Araha.51494s0003.1.p	Arabidopsis halleri	86.9	206	6e-133
AT3G03900.1	Arabidopsis thaliana	85.9	206	5e-132
Eucgr.A02099.1.p	Eucalyptus grandis	86.5	207	8e-132

Showing 1 to 10 of 365 entries

Protein sequence

MSTVGNSTNIFWQECPVGKNERQKLLNQKGCVVWITGLSGSGKSTLACSLGRELHSKGKLSYILDGDNLR
HGLNKDLGFKAEDRTENIRRVGEVAKLFSDAGLICIASLISPYRKDRDACRAMLTDSTFIEVFMNMPLEV
CEKRDAKGLYKLARAGKIKGFTGIDDPYEPPLHCEIELREKDGECPTPSAMAGEVVSYLEEKGFLKAD