Kalax.0517s0004.1.p (PRGDB250315)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB250315	Kalax.0517s0004.1.p	L	putative	LRR	Kalanchoe marnieriana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Kalax.1012s0005.1.p	Kalanchoe marnieriana	90.9	110	1e-58
Kalax.0024s0113.1.p	Kalanchoe marnieriana	90.9	110	1e-58
Glyma.08G152800.2.p	Glycine max	60	110	6e-38
Glyma.08G152800.1.p	Glycine max	60	110	3e-37
Migut.B01332.1.p	Erythranthe guttata	63.5	107	6e-37
Gorai.004G036000.1	Gossypium raimondii	60.9	110	3e-36
orange1.1g017912m	Citrus sinensis	59.1	110	7e-36
Ciclev10031896m	Citrus clementina	59.1	110	7e-36
Thecc1EG005913t1	Theobroma cacao	62.7	110	8e-36
DCAR_006300	Daucus carota	60	110	8e-36

Showing 1 to 10 of 499 entries

Protein sequence

MTGSLSTSICHLDSLTTLVIADWKGISGFIPTCIPSSLPKLRILNLIGNSFSGPIPSDIGALSKLRVLNL
AGNCLTGAIPSSQTQMQDLRHLSLTNNKLSGNIPANLVNIPAC