MDP0000220546 (PRGDB258286)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258286	MDP0000220546	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000573414	Malus domestica	85.3	143	3e-82
MDP0000310472	Malus domestica	83.2	161	4e-82
MDP0000661138	Malus domestica	63.7	171	2e-66
MDP0000946278	Malus domestica	60.8	171	4e-63
MDP0000601632	Malus domestica	60.8	171	5e-63
MDP0000314565	Malus domestica	65.5	171	6e-63
MDP0000487979	Malus domestica	67.8	143	4e-61
MDP0000173893	Malus domestica	64.1	170	2e-60
Prupe.2G126100.1.p	Prunus persica	58.8	170	5e-56
Prupe.2G127000.2.p	Prunus persica	55.8	172	7e-55

Showing 1 to 10 of 499 entries

Protein sequence

MAHVRAAQGTSSDSNTRPKAKTTRRTFTDHLYIALKNTGFFTFRDDDELKRGEYIKPRLQKAIRQSQTSV
VVFSKDYASSRWTTSDHVVLPVFHGVEPSHVGKQMRSIGNAFARHEKTQSPNKVKGWRKALAEVADLAGM
VFSNEAXG