MDP0000398623 (PRGDB258294)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258294	MDP0000398623	T	putative	TM, TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000372663	Malus domestica	91.1	90	5e-50
MDP0000737010	Malus domestica	68.8	122	7e-43
MDP0000398639	Malus domestica	81.3	91	4e-42
MDP0000749555	Malus domestica	63.9	122	5e-42
MDP0000498615	Malus domestica	74.4	90	6e-42
MDP0000386726	Malus domestica	81.3	91	6e-42
MDP0000948085	Malus domestica	74.4	90	1e-41
MDP0000704959	Malus domestica	75.3	89	2e-41
MDP0000586712	Malus domestica	75.8	91	1e-40
MDP0000484463	Malus domestica	66.9	121	2e-40

Showing 1 to 10 of 499 entries

Protein sequence

MNTSSLALATAAAAGSSSSRRSNLRGEDTRTGFTDHLSIALSSAEINTFIDYELRNGENIQRELDREIEG
SRIAVVVFSKSYAESRYCLRELSMITRCREDQEGKVVYPIFYE