MDP0000202038 (PRGDB258296)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258296	MDP0000202038	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000216668	Malus domestica	80.2	157	3e-77
MDP0000661138	Malus domestica	58	157	3e-55
MDP0000168302	Malus domestica	70.1	127	3e-54
MDP0000314565	Malus domestica	56.7	157	2e-52
MDP0000946278	Malus domestica	54.1	157	4e-52
MDP0000601632	Malus domestica	54.1	157	5e-52
MDP0000487979	Malus domestica	69.7	109	3e-50
MDP0000173893	Malus domestica	57.7	156	3e-50
Prupe.2G126400.1.p	Prunus persica	68.8	109	4e-47
Prupe.2G126900.1.p	Prunus persica	68.8	109	6e-46

Showing 1 to 10 of 499 entries

Protein sequence

MALVRTTQGASSDSNTRRGYRTFRDDDELKTGEDIKSGLKQAIQMSRTSVIVFSKDYASSRWCLNELVEI
VDHKRASSDHVVIPVFYDVDPSHVRKQTGSIAEAFAGHRKTEPPDMMERWRKALAELQI