MDP0000552995 (PRGDB258305)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258305	MDP0000552995	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000749555	Malus domestica	74.9	175	8e-82
MDP0000427071	Malus domestica	79.1	153	6e-76
MDP0000484463	Malus domestica	71.9	178	9e-75
MDP0000680893	Malus domestica	81.7	175	1e-74
MDP0000498615	Malus domestica	74.3	175	5e-74
MDP0000948085	Malus domestica	74.3	175	9e-74
MDP0000425190	Malus domestica	76	175	2e-72
MDP0000396307	Malus domestica	75.6	176	3e-70
MDP0000652722	Malus domestica	70.8	178	5e-70
MDP0000309999	Malus domestica	94.7	114	9e-70

Showing 1 to 10 of 499 entries

Protein sequence

MDASSSDHGAAAAASSSSSRSSNRWKYEVFLSFRAQKGGNIQSELDQEIEGSRIAVIVFSKRYAESRWCL
RELSKIMRCLKNQEGKIVCPIFYDVDPSQVRKQKDSFGEAFQKHEKDEDPNVVKQWREDLKASAYLAGWN
LKTTADGAFA