MDP0000827937 (PRGDB258316)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258316	MDP0000827937	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000719464	Malus domestica	85.8	183	1e-97
MDP0000191680	Malus domestica	76.9	160	8e-78
Prupe.1G550800.6.p	Prunus persica	67.8	183	2e-73
Prupe.1G550800.4.p	Prunus persica	67.8	183	1e-72
Prupe.1G550800.3.p	Prunus persica	67.8	183	1e-72
Prupe.1G550800.2.p	Prunus persica	67.8	183	1e-72
Prupe.1G550800.5.p	Prunus persica	67.8	183	1e-72
Prupe.1G550800.1.p	Prunus persica	67.8	183	1e-72
MDP0000877582	Malus domestica	65.9	173	3e-65
MDP0000177665	Malus domestica	67	173	4e-63

Showing 1 to 10 of 499 entries

Protein sequence

MDTSTALEASCPSSPSSPTSSSSSIEDEIYDVFLSFSGEDTRKTFTDHLYWTLKAARVDTFIDENESMSI
GETISDKVKQAIQGSRIAVIIFSRRYADSIWCLEELVKIMECKRTMGQMVLPIFYDVDPSDVKNQSGTFA
EAFQKHKDRFHQVKDKEEKLGPWRNALTEAADLPSENFAKTDG