MDP0000303983 (PRGDB258320)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258320	MDP0000303983	T	putative	TM, TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000297456	Malus domestica	87.2	133	2e-79
MDP0000586712	Malus domestica	60.8	176	2e-63
MDP0000737010	Malus domestica	61	177	4e-61
MDP0000427071	Malus domestica	60.8	176	2e-60
MDP0000680893	Malus domestica	60.8	176	9e-60
MDP0000393857	Malus domestica	65.8	158	2e-59
MDP0000264975	Malus domestica	60.8	176	3e-59
MDP0000260910	Malus domestica	62	158	4e-59
MDP0000948085	Malus domestica	68.3	142	5e-59
MDP0000425190	Malus domestica	59.7	176	7e-59

Showing 1 to 10 of 499 entries

Protein sequence

MSRIFARAVIVLIHNHVFILIFQQNHLSYALREAGINTFTDDKLRRGENIQSELDREIEGSRIAVVVFSK
SYAESRWCLRELSKIRREGKVVYPIFYDVNPSQLREQSGSLGEAFRKEDPNEVEQWRRDLKACADLSGRT
FKTTAGGREALFIRNVVREIIGLTKPRDLQPSQALGWNTLSRVQVFASHFFFAVVKE