MDP0000127348 (PRGDB258325)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258325	MDP0000127348	T	putative	TM, TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000816743	Malus domestica	81.6	136	3e-71
MDP0000573171	Malus domestica	81.9	127	1e-66
MDP0000376600	Malus domestica	81.1	127	4e-63
MDP0000566643	Malus domestica	75.7	136	3e-61
MDP0000507277	Malus domestica	74.4	129	2e-60
MDP0000166360	Malus domestica	76	129	3e-59
MDP0000443113	Malus domestica	72.1	129	8e-59
MDP0000252069	Malus domestica	75.2	129	1e-58
MDP0000289517	Malus domestica	70.5	129	6e-57
MDP0000292029	Malus domestica	75	112	5e-54

Showing 1 to 10 of 499 entries

Protein sequence

MALXXSTQRVSASFLSNESAPLWKYDVILSFRGVDTRKXFVSHLYHELWECQGITTFFDDRVFEEGTSIP
LELPSAIKESHIAIIVLLPNYASSKWCLDELTTILQCMEGRNPVLPIFYETDPSDVENQLDVLLKSSQSM
KKTSSLPKTKRR