MDP0000486254 (PRGDB258343)

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258343	MDP0000486254	T	putative	TIR	Malus domestica

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000679420	Malus domestica	73.2	138	2e-61
MDP0000839291	Malus domestica	74.6	138	1e-60
MDP0000535062	Malus domestica	71.8	142	4e-59
MDP0000527962	Malus domestica	65.1	149	4e-57
MDP0000504579	Malus domestica	63.5	137	1e-55
MDP0000460948	Malus domestica	79.7	118	1e-55
MDP0000529326	Malus domestica	73.2	138	1e-55
MDP0000468499	Malus domestica	73.2	138	1e-54
MDP0000681569	Malus domestica	88.9	108	2e-53
MDP0000902193	Malus domestica	84.9	106	1e-52

Showing 1 to 10 of 499 entries

MVDTAMTTHEASSSSSSKSKLWNYDVFLSFSGVDTRNGFTGHLHRALTDRGYQAYIDEDDLKRGEEIQKE
LFQAIEESKISIIVFSKRYASSSWCLNELMKIIECRDKLERHAYLIPPTLAGSQPTPSPSIVDSHPVNLP
LPTPNP