MDP0000679401 (PRGDB258351)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258351	MDP0000679401	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000498615	Malus domestica	91.4	116	5e-75
MDP0000948085	Malus domestica	91.4	116	2e-74
MDP0000749555	Malus domestica	79.7	138	2e-72
MDP0000652722	Malus domestica	87.9	116	6e-71
MDP0000425190	Malus domestica	90.5	116	3e-69
MDP0000393857	Malus domestica	91.4	116	7e-69
MDP0000427071	Malus domestica	90.5	116	3e-68
MDP0000680893	Malus domestica	90.5	116	3e-67
MDP0000396307	Malus domestica	90.5	116	8e-67
MDP0000586712	Malus domestica	89.7	116	2e-66

Showing 1 to 10 of 499 entries

Protein sequence

MDTSSSASEAGSNRWKYEVFLSFRGEDTRNAFTNHLFIALRNAGINTFIDNQLTRGKTIQSELDQEIEGS
RIALLVFSKGYAESRWCLRELSKIMRCLKEQEGKIVCPIFYDVDPSQVRKQKGSFGEA