MDP0000688456 (PRGDB258357)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258357	MDP0000688456	CT	putative	CC, TM, TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000468314	Malus domestica	99.9	153	1e-102
MDP0000797088	Malus domestica	94.8	153	4e-98
MDP0000394411	Malus domestica	87.8	156	8e-96
MDP0000685087	Malus domestica	93.5	153	5e-89
MDP0000769222	Malus domestica	90.2	153	8e-87
MDP0000748669	Malus domestica	91.5	153	3e-86
MDP0000483489	Malus domestica	86.9	153	4e-86
MDP0000720656	Malus domestica	92.2	153	1e-85
MDP0000373434	Malus domestica	92.2	153	2e-85
MDP0000746482	Malus domestica	81.9	160	2e-81

Showing 1 to 10 of 499 entries

Protein sequence

MTAHEASSSSSSNSKLWKYDVFLSFRGEDTRYGFTSHLHAALKARGYQVFIDEDDLQRGEEIKEKLFRAI
EESMISVIIFSKMYANSSWCLDELVKIMACRDKLGRHVLPIFYHVDPSHVRKQDGDLAEAFQKHKKDIRE
EKDDKKREAKQEREEAEKGSYRSYKFV