MDP0000753149 (PRGDB258374)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258374	MDP0000753149	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000376721	Malus domestica	99	100	8e-65
MDP0000668433	Malus domestica	82.2	90	5e-46
MDP0000399716	Malus domestica	82.2	90	3e-45
MDP0000481803	Malus domestica	77.3	88	2e-44
MDP0000125643	Malus domestica	78.5	93	3e-44
MDP0000540495	Malus domestica	70.9	103	1e-43
MDP0000392360	Malus domestica	72.8	103	1e-41
MDP0000580157	Malus domestica	69.5	95	6e-41
MDP0000506162	Malus domestica	75.6	90	9e-41
MDP0000637513	Malus domestica	70	90	2e-39

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSSFSSVPDWKYDVFLNFRGEDTRXTFIGHLYKALVQNSINTFIDAEKLRKGKDLSQLLTAISDSR
LSVVVFSQNYASSTWCLKELVQILQCMDQKNRL