MDP0000445391 (PRGDB258376)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258376	MDP0000445391	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000710944	Malus domestica	91.1	90	6e-54
MDP0000719767	Malus domestica	85.9	92	3e-50
MDP0000561399	Malus domestica	82.8	93	2e-48
MDP0000864830	Malus domestica	77.4	93	1e-47
MDP0000710999	Malus domestica	77.7	103	4e-47
MDP0000724110	Malus domestica	85.9	92	5e-47
MDP0000449255	Malus domestica	79.6	93	1e-46
MDP0000771204	Malus domestica	80	90	1e-46
MDP0000610729	Malus domestica	80	90	2e-46
MDP0000527034	Malus domestica	80.7	88	1e-45

Showing 1 to 10 of 499 entries

Protein sequence

MEVIGTSSGAADSVTAVDDVNIPPLREKYDVFLSFRGEDTRLTFTSHLHAALLRKKIETYIDNRLKKGDE
IGPALREAIEKSRLSVIIFSKNHASSTWCLNELVHILECKKI