MDP0000294364 (PRGDB258407)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258407	MDP0000294364	N	putative	NBS, TM	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000299934	Malus domestica	84.2	202	5e-110
MDP0000291205	Malus domestica	78.7	178	9e-81
MDP0000210357	Malus domestica	56.9	248	1e-75
MDP0000200122	Malus domestica	50.4	276	7e-68
MDP0000190871	Malus domestica	67.4	178	6e-65
MDP0000297478	Malus domestica	66.8	178	2e-64
Lus10032759	Linum usitatissimum	41.6	269	4e-53
Prupe.1G389500.1.p	Prunus persica	59	178	4e-53
Manes.05G169600.1.p	Manihot esculenta	53.9	178	2e-49
Gorai.009G208600.1	Gossypium raimondii	55.1	178	2e-49

Showing 1 to 10 of 169 entries

Protein sequence

IVNXCKXLPLALKVIGASLXXQXELCWANARSKLSKGEAFCESHENNLLIQTKEAFAILVELSNKNLLTL
VKDARDGDIYSSCYDISVTQHDVLRDLALHLRNDGSVNERGRLLMPGRETELPREWERDSDQPLVIAFID
YEALPASICELRCLKYIDISQCVNLRCLPMDIELLGFWFCTKLLGNWVSRFRLAFRLAPPRPPSAA