MDP0000318900 (PRGDB258479)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258479	MDP0000318900	RLP	putative	LRR, TM	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000274313	Malus domestica	84.7	183	2e-105
MDP0000157225	Malus domestica	82.9	123	1e-64
MDP0000222790	Malus domestica	81	121	3e-59
MDP0000171644	Malus domestica	76.7	129	3e-56
MDP0000252113	Malus domestica	82	122	1e-55
MDP0000291035	Malus domestica	81	121	1e-54
Prupe.7G139600.1.p	Prunus persica	68.3	123	6e-50
Prupe.7G139800.1.p	Prunus persica	68.1	119	3e-47
mrna24126.1-v1.0-hybrid	Fragaria vesca	62.6	123	1e-45
mrna24117.1-v1.0-hybrid	Fragaria vesca	62	121	3e-44

Showing 1 to 10 of 499 entries

Protein sequence

MSLASVGMGALRMAFEMLFDAVKLAHEENKMFQHLSRDIMSTLDSVQPLIKDFEKRIGKSKNLEMLRLRS
CTELSKLPTTMKNLGKVKFLDISVCFSIKMLPKDLGEMSSLKKINMRQCSRLQELPPSVMDLKQLKEVVC
DEETKYLWEYFSLCLNNVRIIVARENINLNWIHKTQF