MDP0000709653 (PRGDB258641)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258641	MDP0000709653	RLP	putative	LRR, TM	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000163105	Malus domestica	80.5	169	8e-80
MDP0000200036	Malus domestica	80.5	169	3e-78
MDP0000255887	Malus domestica	80.5	169	3e-78
MDP0000144730	Malus domestica	61.7	167	2e-57
Prupe.1G165300.2.p	Prunus persica	63.5	167	4e-55
Prupe.1G165300.1.p	Prunus persica	63.5	167	4e-55
Prupe.8G022800.1.p	Prunus persica	57.3	164	2e-47
Prupe.6G160100.1.p	Prunus persica	53	166	7e-47
Solyc06g065140.1.1	Solanum lycopersicum	48.2	168	2e-46
Prupe.8G021700.1.p	Prunus persica	53.4	163	4e-45

Showing 1 to 10 of 499 entries

Protein sequence

MRTPYFTEIXNLERLVLEGCYDLIEIHPSIAALKRXKILNFKNCMSMKSLPSEIAMESLEFLSLSRCVNL
KKIPEFVGDMKNLSRLILSETAIKEIPPSIGCLIGLVELHLDGCQSLLCVPSVISNCKSLKLLNMLGCSK
LSKLPESLGVMDYLEELDLSRTALKELPSX