MDP0000711806 (PRGDB258677)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258677	MDP0000711806	L	putative	LRR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000738947	Malus domestica	99.3	153	2e-104
MDP0000565527	Malus domestica	82.7	150	9e-73
MDP0000577796	Malus domestica	77.3	150	1e-69
MDP0000393752	Malus domestica	77.3	150	4e-67
MDP0000675405	Malus domestica	78.3	152	8e-67
MDP0000430035	Malus domestica	82.7	150	3e-64
MDP0000480497	Malus domestica	71.6	148	7e-63
MDP0000640736	Malus domestica	75	152	1e-62
MDP0000754718	Malus domestica	73.7	152	3e-60
MDP0000582438	Malus domestica	72.7	150	5e-60

Showing 1 to 10 of 499 entries

Protein sequence

MDFYKLKSVGTLLLNGCWKFRELHEDIGEMISLRTLEAEQTAIKEVPPSIVGLKNLTRLSLECNLSGIQL
PHSLLGLNSLXELNLSWCKLADDAIPKDLGSLISLQVLDLSWNVFHTXPSLSGLSKLETLRLHNCFNLRT
IPDIPPNVEVQLV