MDP0000169103 (PRGDB258849)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258849	MDP0000169103	L	putative	LRR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000251508	Malus domestica	95.9	49	4e-25
MDP0000634241	Malus domestica	65.9	85	3e-24
Prupe.4G145700.1.p	Prunus persica	63.2	76	2e-20
mrna10374.1-v1.0-hybrid	Fragaria vesca	57.9	76	4e-17
Glyma.08G174500.1.p	Glycine max	67.9	53	7e-15
orange1.1g001274m	Citrus sinensis	56.1	66	5e-14
Glyma.15G252600.2.p	Glycine max	50.7	75	3e-13
Glyma.15G252600.1.p	Glycine max	50.7	75	3e-13
Ciclev10018604m	Citrus clementina	54.5	66	4e-13
Migut.M00666.1.p	Erythranthe guttata	65.3	49	7e-13

Showing 1 to 10 of 344 entries

Protein sequence

MLTXFCKMTNLRKLXLCENYVFGEMPEEIXNLASLEELFLCSNNLTGVIPTSIRTYIDKKCSFTGNVSIR
GRILAGTCHSAKTNKTIIVRRNYLHYIKKYQRPLSKSKRFNLLKVTPAGSSGTGRKAFAGI