MDP0000157529 (PRGDB259289)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB259289	MDP0000157529	RLP	putative	LRR, TM	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000242815	Malus domestica	92.7	179	2e-104
MDP0000206057	Malus domestica	84.4	179	2e-95
MDP0000223990	Malus domestica	81.6	179	3e-90
MDP0000304815	Malus domestica	82	178	7e-89
MDP0000259702	Malus domestica	82	178	1e-88
MDP0000723184	Malus domestica	82	178	2e-88
MDP0000281627	Malus domestica	81	179	2e-82
MDP0000808157	Malus domestica	72.6	179	2e-81
MDP0000268795	Malus domestica	71	176	3e-77
Prupe.1G575200.1.p	Prunus persica	70	180	1e-74

Showing 1 to 10 of 499 entries

Protein sequence

MLSGEILEEQTSLIRLQTLNLSDNLLTGRIPSKIGDMAMLESLDLSVNQLSGEISPSISNLTFLNYLNLS
YNNLIGQIPKSTQLQSFDLSTYAGNKLCGPPLEECRITNDVVPPVANEKQGEGHLLEDNWFYLSLGLGFA
FGFWIVLGSLLSSVPWSNAFSRFQNRIVKKLYAAIVKRY