MDP0000456267 (PRGDB259601)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB259601	MDP0000456267	KIN	putative	TM, Kinase	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000185190	Malus domestica	99.9	187	4e-132
mrna19308.1-v1.0-hybrid	Fragaria vesca	94.7	187	6e-127
Prupe.2G170900.2.p	Prunus persica	93.6	187	4e-124
Prupe.2G170900.3.p	Prunus persica	93.6	187	9e-124
Prupe.2G170900.4.p	Prunus persica	93.6	187	1e-123
Prupe.2G170900.1.p	Prunus persica	93.6	187	5e-123
MDP0000198034	Malus domestica	91.4	186	1e-116
30174.m008609	Ricinus communis	86.6	187	6e-116
orange1.1g010882m	Citrus sinensis	86.1	187	5e-114
Gorai.001G169300.5	Gossypium raimondii	85	187	3e-113

Showing 1 to 10 of 499 entries

Protein sequence

MDPEFLASGELTPKSDVYSFGIILLRLLTGKQALGITKEVQYALDSGKLEMLLDPLAGDWPFVQAEQLAR
LALRCCEMSRKCRADLVSDVWRVLEPMRASCGCSSSFLLGTEEHFQPPSYFICPIFQEVMQDPHVAADGF
TYEAEALKGWLDSGHDTSPMTNLKLEHKNLVPNHALRSAIQEWLQQH