MDP0000861485 (PRGDB260339)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB260339	MDP0000861485	KIN	putative	Kinase	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000227239	Malus domestica	88.9	72	2e-40
MDP0000318702	Malus domestica	83.3	72	7e-38
MDP0000253454	Malus domestica	88.4	69	1e-37
Prupe.1G469000.1.p	Prunus persica	79.2	72	1e-36
MDP0000253455	Malus domestica	84.1	69	3e-36
MDP0000303194	Malus domestica	79.2	72	5e-35
29842.m003671	Ricinus communis	81.2	69	2e-34
mrna25423.1-v1.0-hybrid	Fragaria vesca	77.8	72	3e-34
Kalax.1511s0004.1.p	Kalanchoe marnieriana	79.7	69	6e-34
Manes.02G155600.2.p	Manihot esculenta	73.6	72	1e-33

Showing 1 to 10 of 499 entries

Protein sequence

MYYPARRTHLDWDSRYKMIFGIGRGLLYLHEDSHLKIIHRDLKASNILLDVEMQPKIADFGMARLFDLDQ
TR