EMT15539 (PRGDB2615)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2615	EMT15539	KIN	putative	TM, Kinase	Aegilops tauschii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_2DL_77990F25A.1	Triticum aestivum	66.8	196	5e-88
MLOC_70652.1	Hordeum vulgare	63.8	196	1e-79
Brast07G149300.1.p	Brachypodium stacei	63.2	201	2e-78
Traes_1DS_26F1546F6.1	Triticum aestivum	66.3	196	5e-78
Traes_1DS_26F1546F6.2	Triticum aestivum	66.3	196	5e-78
Traes_5DS_C16C07DD1.2	Triticum aestivum	67.7	186	5e-78
Traes_5DS_C16C07DD1.3	Triticum aestivum	67.7	186	5e-78
Traes_2BL_D7E37D22E.1	Triticum aestivum	63.9	194	1e-76
Pavir.Ca02642.5.p	Panicum virgatum	61.4	202	4e-75
Pavir.Ca02642.4.p	Panicum virgatum	61.3	199	1e-74

Showing 1 to 10 of 499 entries

Protein sequence

MQFEKEVCHLMTVKHPNIVQCVGYCYETLKEVAPYNGKMVFAEKSEMLLCLEYLPTGSLSEYLSDESCGL
NWSTRYKIIKGTCYGLCHLHGQKDTPIIHLDLKPTNILLSDGMIAKIADFGLSRLLEQPGTIITSSRFGT
PGYMAPEFFEESGPALSTKSDIFSLGVIIIEIITGRRKYPRDVTEPSSSNEFVEMVLCN