Medtr2g079900.1 (PRGDB266640)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB266640	Medtr2g079900.1	T	putative	TIR	Medicago truncatula

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Medtr2g079950.1	Medicago truncatula	99.9	190	3e-140
Glyma.12G221600.1.p	Glycine max	80	170	6e-96
Glyma.13G279700.1.p	Glycine max	78.8	170	7e-95
Phvul.005G084100.1	Phaseolus vulgaris	77.7	170	1e-94
Potri.011G123100.1	Populus trichocarpa	64.4	177	1e-81
Glyma.06G248700.1.p	Glycine max	69.1	162	2e-81
28108.m000142	Ricinus communis	65.7	169	1e-80
Potri.001G403800.1	Populus trichocarpa	64.2	176	4e-80
Manes.15G084900.1.p	Manihot esculenta	65.7	169	7e-80
SapurV1A.0401s0200.1.p	Salix purpurea	65.1	169	3e-79

Showing 1 to 10 of 499 entries

Protein sequence

MMARRMMEPCDVFLNHRSPDTKRTVATLLYDNLKRHGFNPFLDEKNMKPGDKLFEKINGGVMESKIGVAV
FSPRYCESYFCLHELALLTALKKKVIPIFCDVKPSQLRVVKNAKWSEEELRRFRWALDEAKNTVGLTFNS
SKGNFSKFVTNASNIIIESMTELQNEEKMKCLPSTKLQNEEKMKYLPSRV