Medtr6g078650.1 (PRGDB266643)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB266643	Medtr6g078650.1	T	putative	TM, TIR	Medicago truncatula

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.16G159400.1.p	Glycine max	57.1	112	2e-32
Medtr6g077500.2	Medicago truncatula	58.1	117	1e-31
Medtr6g077500.1	Medicago truncatula	58.1	117	1e-31
Glyma.16G159200.1.p	Glycine max	53.3	120	1e-29
Glyma.16G211400.1.p	Glycine max	56.7	120	3e-29
Phvul.004G136800.1	Phaseolus vulgaris	53	117	5e-29
VIT_18s0117g00380.t01	Vitis vinifera	47.5	120	1e-28
Glyma.19G022700.1.p	Glycine max	54.4	114	2e-28
Medtr5g040460.1	Medicago truncatula	54.2	120	3e-28
Glyma.16G213700.2.p	Glycine max	54.4	114	6e-28

Showing 1 to 10 of 499 entries

Protein sequence

MANLQSSSFSTTYDVFLSFQGHDTCKGFAGDLCKVLSKGRISTFMCDEELFKGDEIPPVLYKVIHESRIA
IIVFTANYASSSFWLEVLGHIVENKSYGLILPVFYDVDPFHVLNQSGTSTQLYPLLLNLIRLQQFNPRNL
APKL