Medtr4g014140.1 (PRGDB266683)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB266683	Medtr4g014140.1	T	putative	TM, TIR	Medicago truncatula

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Medtr4g014120.1	Medicago truncatula	91	156	2e-92
Medtr4g013370.1	Medicago truncatula	76.8	155	1e-75
Medtr4g014770.1	Medicago truncatula	69.2	156	2e-69
Medtr5g031270.1	Medicago truncatula	74.7	150	5e-69
Medtr4g013375.1	Medicago truncatula	71.6	155	2e-68
Glyma.03G047900.1.p	Glycine max	72.4	156	2e-68
Medtr4g014340.1	Medicago truncatula	70.5	156	2e-67
Medtr4g014300.1	Medicago truncatula	69.2	156	7e-67
Glyma.03G048800.1.p	Glycine max	63.5	156	5e-65
Glyma.09G057000.1.p	Glycine max	67.3	156	5e-65

Showing 1 to 10 of 499 entries

Protein sequence

MSNNTPPHSKYDVFVSFSGKDIRSSFLSHLVKAFLQKQINAFVDDKLHRGDDISDSLVEAIKGSSILLII
FSEKYACSHWCLEELVKIVECKEKYAQIVIPVFYRVDPTDVRHQKRSYENAFAEHEKKYSSYEVHMWKHA
LKTSANLSGITSSSFQ