72501 (PRGDB270571)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270571	72501	L	putative	LRR	Micromonas

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
32570	Micromonas pusilla	54.4	193	2e-62
5174	Ostreococcus lucimarinus	48.2	191	1e-46
Pp3c23_1160V3.1.p	Physcomitrella patens	42.6	169	8e-37
Pp3c23_1160V3.3.p	Physcomitrella patens	42.6	169	8e-37
Pp3c23_1160V3.2.p	Physcomitrella patens	42.6	169	8e-37
77808	Micromonas	42.6	169	2e-35
88344	Micromonas	42	169	6e-35
55526	Micromonas	41.8	170	6e-34
85191	Micromonas	43.2	169	9e-34
81826	Micromonas	42	169	2e-33

Showing 1 to 10 of 499 entries

Protein sequence

LDLTGIGLTKVPDEVWTLTDLTDLQLSNNKITRIPNDVGNLAELERLGLAGNRLTEIPEAIGRCERLRHL
MLAGNRIRELPASLGDCKYLEELSVPGNRLESLPETIGGAYMLRVIDVHGNRIARLPDSIARLKSLEELS
AQGNLLTSIPDDVGEMRRLVRLNVAENKL