72677 (PRGDB270573)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270573	72677	L	putative	LRR	Micromonas

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
85191	Micromonas	75.6	156	3e-67
77808	Micromonas	75	156	1e-65
84219	Micromonas	74.4	156	1e-64
109661	Micromonas	71.5	151	3e-62
84418	Micromonas	71.2	156	3e-62
107620	Micromonas	70.5	156	4e-62
81822	Micromonas	71.8	156	7e-62
61018	Micromonas	71.8	156	8e-62
55529	Micromonas	73.9	153	3e-61
87686	Micromonas	74.5	153	9e-61

Showing 1 to 10 of 499 entries

Protein sequence

LVRLILIGNQLTSVPAEIGQLAVLNHLDLANNHLTSVPAEIGQLTSLGCLDLSYNQLTSVPAEIGQLMSL
RRMGLSHNRLTSVPAEIGQLTSVRELYLGGNQLTSVPAEIGQLTSVRELYLGGNQLTSVPAEIGQLASLR
ELHFRGNQLTSVPAEI