89195 (PRGDB270587)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270587	89195	L	putative	LRR	Micromonas

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
81822	Micromonas	66.1	227	1e-86
99220	Micromonas	64.1	223	5e-80
84418	Micromonas	70.5	200	1e-79
55529	Micromonas	74.7	186	6e-79
55526	Micromonas	68.3	205	1e-77
82436	Micromonas	57.5	252	8e-77
78713	Micromonas	68.3	199	7e-76
83010	Micromonas	62.8	223	6e-75
77261	Micromonas	64	225	2e-74
87686	Micromonas	55.8	269	2e-74

Showing 1 to 10 of 499 entries

Protein sequence

MENGRVEVLEFEDCDLTGAVPAEVGRLTALRDLNLQHNELTSVPAEIGQLTSLTSLWLNNNQLTSVPAEI
GQLTSLEGLYLWDNKLTSVPTEIGQLTSLTDLSLGGNQLTSVPAEIGQLTSLRELELYDNQLTSLPAEIG
QLTSLTALFLDDNRLTRVPAEIGQLASLVGLDLQHNKLTSVPAEIAQLRAAGCSVLLDDGVTVDE