66542 (PRGDB270772)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270772	66542	N	putative	NBS	Micromonas

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
30493	Ostreococcus lucimarinus	64.8	529	0
25113	Micromonas pusilla	67.9	529	0
ABY35407.1		37	527	2e-105
ENO88600.1		35.9	537	2e-93
25670	Micromonas pusilla	33.9	510	3e-88
ABY34281.1		33.3	529	3e-65
CMI117CT	Cyanidioschyzon merolae	29.7	538	2e-63
39642	Coccomyxa subellipsoidea	30.4	536	3e-62
Cre01.g034950.t1.2	Chlamydomonas reinhardtii	30.9	564	3e-61
Vocar.0001s0777.1.p	Volvox carteri	30.8	565	3e-59

Showing 1 to 10 of 491 entries

Protein sequence

MPRPRKDKYGMSFVEWCNESGRRGARLLLECREKDPSKFTKGSHYKALWKCAEEKCRHKWRTKVNKRTRS
DRPTGCPKCANQIPRSKSDNFITWCNANGERGKRLLEEFCDTEKKPEELTKASHFKATWNCSTCAHKWRA
VVRDRTRSGRPRGCPECNPGARKRKPKRDDV