31892 (PRGDB270800)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270800	31892	CL	putative	CC, LRR	Micromonas pusilla

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
55405	Micromonas	54.2	249	1e-97
Vocar.0001s0903.1.p	Volvox carteri	42.6	303	3e-67
Cre01.g029150.t1.2	Chlamydomonas reinhardtii	41.5	304	9e-66
17495	Coccomyxa subellipsoidea	45.5	211	9e-54
Mapoly0040s0039.1.p	Marchantia polymorpha	40.4	245	3e-49
EFJ33710	Selaginella moellendorffii	43.3	215	8e-48
Pp3c10_6730V3.2.p	Physcomitrella patens	38.7	222	2e-43
Pp3c10_6730V3.1.p	Physcomitrella patens	38.7	222	2e-43
EFJ37058	Selaginella moellendorffii	41.9	203	2e-41
Vocar.0033s0170.1.p	Volvox carteri	37.8	246	1e-40

Showing 1 to 10 of 83 entries

Protein sequence

MKAKAPQAQGMRWMKRCKRRAKERARARAEWGEANGADARAETTTTETTETTETETTTTTTTSALDRALQ
SGKKKNKGKAKKKESYAVRAASTVRAGVSKKRDGAKTSEATAPKYASGNPFAALAMARKR