GSMUA_Achr3P00980_001 (PRGDB272926)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB272926	GSMUA_Achr3P00980_001	RLP	putative	LRR, TM	Musa acuminata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
mrna17736.1-v1.0-hybrid	Fragaria vesca	50.5	97	5e-22
Aqcoe7G248100.1.p	Aquilegia caerulea	55.7	88	7e-22
Gorai.012G009700.2	Gossypium raimondii	49.5	97	2e-21
Gorai.012G009700.1	Gossypium raimondii	50	94	2e-21
Bradi4g05479.1.p	Brachypodium distachyon	51.6	95	3e-21
GRMZM5G841015_P01	Zea mays	49.5	97	4e-21
MDP0000228139	Malus domestica	45.8	96	5e-21
Sobic.005G204500.1.p	Sorghum bicolor	49.5	97	6e-21
Potri.014G036700.1	Populus trichocarpa	51.6	95	6e-21
Pavir.J39952.1.p	Panicum virgatum	52.6	95	8e-21

Showing 1 to 10 of 499 entries

Protein sequence

MPNDPLVKVITSIDLNDVDIVGYLPAELDLLIDVTSSSSILIASTISSPKISRLKLLHELDANNNRFVGP
FPNIALHLLSIKYLNLWFNDFEGV