EMT16247 (PRGDB2731)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2731	EMT16247	KIN	putative	Kinase	Aegilops tauschii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
TRIUR3_09840-P1	Triticum urartu	93.2	117	5e-76
Traes_2DL_F683AFF2B.2	Triticum aestivum	80.6	139	7e-72
Traes_2DL_F683AFF2B.1	Triticum aestivum	80.6	139	3e-70
Traes_2BL_09098E11D.1	Triticum aestivum	77.7	139	2e-67
EMT02926	Aegilops tauschii	81	116	2e-61
Traes_2BL_4F79CF542.1	Triticum aestivum	69.1	139	7e-60
Traes_2BL_4F79CF5421.1	Triticum aestivum	69.1	139	7e-60
Traes_2DL_F7A15433F.2	Triticum aestivum	68.1	138	2e-59
MLOC_11271.8	Hordeum vulgare	65.7	143	5e-59
MLOC_11271.4	Hordeum vulgare	65.7	143	5e-59

Showing 1 to 10 of 499 entries

Protein sequence

MTIIHRDLKPSNILLDSEMNAKIADFGMARIFGGNEQHERTKHVVGTYGYMSPEYAMEGIFSLKSDTYSF
GIFLLEIAWNLWKDGKSMDFMDATLTESYSPDEVSKCIHIGLIMQPDLHLTRYTYMQLESRIVFVKKAMK
TVTHQDSGRAFDGFPFHLGQKAIKAPKAPI