Araha.66827s0001.1.p (PRGDB28336)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28336	Araha.66827s0001.1.p	T	putative	TM, TIR	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT5G38344.1	Arabidopsis thaliana	76.7	206	1e-104
860415	Arabidopsis lyrata	75.2	206	1e-103
Bostr.12645s0023.1.p	Babiana stricta	76.7	206	5e-100
860417	Arabidopsis lyrata	77.2	206	8e-100
860423	Arabidopsis lyrata	76.7	206	7e-97
Cagra.1761s0003.1.p	Conradina grandiflora	69.4	206	7e-93
AT5G38340.1	Arabidopsis thaliana	71.9	203	9e-93
Bostr.18473s0377.1.p	Babiana stricta	68.8	186	2e-88
Bostr.18473s0359.1.p	Babiana stricta	70.9	206	3e-88
Bostr.0556s0798.1.p	Babiana stricta	70.4	206	3e-86

Showing 1 to 10 of 499 entries

Protein sequence

MDSSFSFRFCATAITFFTFSGTIYFMFYRKFRFHHENKAETSTTATSSSSLSIPSSLSRNWKHHVFPNFH
GPDVRKTFLAHMLKEFKGKGIDSFIDNDIERTKSIGPELIEAIRGSKIAIVLLSKNYASSSWCLNELMEI
MNCREDLGQIVMTIFYEVDPTDVKKQTGDFGKAFKKSCKGKTKEEIKGWKKALDGVATIAGEHSRN