Araha.59926s0001.1.p (PRGDB28339)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28339	Araha.59926s0001.1.p	T	putative	TIR	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.38723s0001.1.p	Arabidopsis halleri	95.9	170	2e-111
869024	Arabidopsis lyrata	93.5	170	9e-104
859975	Arabidopsis lyrata	79.6	201	3e-101
Bostr.7200s0182.1.p	Babiana stricta	86.3	161	1e-98
Bostr.7200s0103.1.p	Babiana stricta	81.4	161	4e-97
AT5G41750.2	Arabidopsis thaliana	84.1	170	6e-95
AT5G41750.1	Arabidopsis thaliana	84.1	170	6e-95
Bostr.7200s0101.1.p	Babiana stricta	80.6	170	7e-95
Bostr.7200s0171.1.p	Babiana stricta	81.4	167	1e-94
Bostr.7200s0098.1.p	Babiana stricta	82.6	161	3e-94

Showing 1 to 10 of 499 entries

Protein sequence

MASSSFLSCIKRYHVFSSFHGPDVRRGFLSHLHNHFASKGITTFNDEKIDRGQTIGPELVQAIRESRVSI
VLLSKNYASSSWCLDELLEILKCKEAQGQIVMTIFYDVDPSDVKKQRGEFGKAFEKTCQGKTEELKQRWS
KALAHVATIAGEHSLNWANEAEMIQKIATD