Araha.38064s0001.1.p (PRGDB28412)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28412	Araha.38064s0001.1.p	RLP	putative	LRR, TM	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.47979s0001.1.p	Arabidopsis halleri	63	181	4e-75
Araha.17322s0001.1.p	Arabidopsis halleri	72	161	7e-70
AT1G58190.2	Arabidopsis thaliana	64.7	173	1e-68
AT1G58190.1	Arabidopsis thaliana	64.7	173	1e-68
Araha.32379s0001.2.p	Arabidopsis halleri	48.2	168	2e-44
Araha.32379s0001.1.p	Arabidopsis halleri	48.2	168	6e-44
Araha.25436s0004.1.p	Arabidopsis halleri	46.2	173	4e-41
Araha.23894s0001.1.p	Arabidopsis halleri	49.1	165	4e-41
Araha.11699s0001.1.p	Arabidopsis halleri	42.9	196	3e-40
Thhalv10018093m	Eutrema salsugineum	44.8	172	4e-40

Showing 1 to 10 of 499 entries

Protein sequence

MSNKRFLMFMFSPPCFMMVVVVMMMMVSLHVHGYRGCIESERKGLMELKAYLNTSEYPYDWPNDTNSDCC
RWERVKCDLNTGRVISLFLIETYNHPPLLNLSLFYPFQELQILNLSTFRGQDWFDDIYGYKSLGRLKNLK
ILDLSDTGVNNSVLPFLNSAASLETLILHGNYMEGTFPMKGTSTFRFLLSLSRSY